Halysis
Incretins and amylin
Cagrilintide
Size per vial
€40 excl. tax, per vial
Ref. CGL2 · Indicative price, confirmed by quote. Sold to verified trade accounts only.Identity sheet
| Type | Synthetic peptide |
|---|---|
| CAS No. | 1415456-99-3 |
| Molecular formula | C194H312N54O59S2 |
| Molar mass | 4,409.01 g/mol |
| Sequence | N-alpha-(19-carboxynonadecanoyl-gamma-Glu)-KCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP-NH2 (disulfide Cys2-Cys7; C-terminal prolinamide) |
| Length | 37 residues |
| Form | Lyophilised powder, crimped glass vial |
| Sizes | 2 mg · 5 mg · 10 mg |
| Purity | Stated on the batch certificate of analysis |
| Storage | −20 °C, away from light and moisture |
Description
The full technical data sheet of the compound is sent with the quote.
Documents
| Certificate of analysis | Supplied with every batch delivered |
|---|---|
| Safety data sheet | On request |
Research use only. Laboratory reagent, not intended for human or animal administration. It is not a medicine, a supplement or a cosmetic. Use policy