Halysis
Matrix and copper peptides
B7-33
B7-33 (single-chain relaxin-2 B-chain analogue)
Size per vial
€44 excl. tax, per vial
Ref. B7-332 · Indicative price, confirmed by quote. Sold to verified trade accounts only.Identity sheet
| Type | Synthetic peptide |
|---|---|
| Name | B7-33 (single-chain relaxin-2 B-chain analogue) |
| CAS No. | 1818415-56-3 |
| Molecular formula | C131H229N41O36S |
| Molar mass | 2,986.54 g/mol |
| Sequence | H-Val-Ile-Lys-Leu-Ser-Gly-Arg-Glu-Leu-Val-Arg-Ala-Gln-Ile-Ala-Ile-Ser-Gly-Met-Ser-Thr-Trp-Ser-Lys-Arg-Ser-Leu-NH2 (VIKLSGRELVRAQIAISGMSTWSKRSL-NH2) |
| Length | 27 residues |
| Form | Lyophilised powder, crimped glass vial |
| Sizes | 2 mg · 10 mg |
| Purity | Stated on the batch certificate of analysis |
| Storage | −20 °C, away from light and moisture |
Identifiers to be confirmed on the batch certificate of analysis.
Description
The full technical data sheet of the compound is sent with the quote.
Documents
| Certificate of analysis | Supplied with every batch delivered |
|---|---|
| Safety data sheet | On request |
Research use only. Laboratory reagent, not intended for human or animal administration. It is not a medicine, a supplement or a cosmetic. Use policy